SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010529 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010529
Domain Number 1 Region: 412-526,646-761
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.13e-55
Family Phosphate binding protein-like 0.00000000289
Further Details:      
 
Domain Number 2 Region: 23-388
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.39e-55
Family L-arabinose binding protein-like 0.0077
Further Details:      
 
Domain Number 3 Region: 542-645
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000033
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010529   Gene: ENSVPAG00000011309   Transcript: ENSVPAT00000011309
Sequence length 881
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_821:207428:370594:1 gene:ENSVPAG00000011309 transcript:ENSVPAT00000011309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKIMHISVLLCPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDRKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLRIQFGGANVSGFHIVDYDDSLVSKFIKRWSTLQKYPEAHTTTISYTSALTYD
AVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKF
DQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTIL
ESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWN
GMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPL
AYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWFSL
GAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSK
QTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYA
YLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXNKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAE
AKRMKVAKSAQNINPSSSQNSQNFATYKEGYNVYGIESVKI
Download sequence
Identical sequences ENSVPAP00000010529 ENSVPAP00000010529

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]