SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010626 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010626
Domain Number 1 Region: 1-28,130-246,367-500
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.34e-34
Family Quinoprotein alcohol dehydrogenase-like 0.044
Further Details:      
 
Weak hits

Sequence:  ENSVPAP00000010626
Domain Number - Region: 1-107
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000549
Family WD40-repeat 0.015
Further Details:      
 
Domain Number - Region: 264-412
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00228
Family Quinohemoprotein amine dehydrogenase B chain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010626   Gene: ENSVPAG00000011407   Transcript: ENSVPAT00000011408
Sequence length 757
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_967:92881:110569:1 gene:ENSVPAG00000011407 transcript:ENSVPAT00000011408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYSCSFDGTIKLWDYIDGILIKTFIVGHKLHALFSLACAEDSVFVIINKEKPDIFQLVSV
KLPRSSSQEIEAKELSIVLDYINQSPKCIAFGNEYVAAVRDFYLSVYFFKKKTTSRFTLS
SSRNKKHAKNNFTCVACHPKEDCIATGHKDGKIRLWRNFDDEKKYTYTCLHWHHDLVMDL
AFSVTGSSLLSGGRESVLVEWREATEKNKEFLPRLGATIVHISVSPAGDLFCTSHSDNKI
IIIHRNLEASAVIQGLVKDSNIFTGLMIDPRTKALVLNGKPGHLQFYSLQSDKQLYNLDI
IQQEYINDYGLIQIELTKAAFGCYGNWLATVEQRQEKETELELQMKLWMYNKKTQGFVLN
TKINMPHEDHITDLCFCNAEKSENPTLVTASRDGHFKVWILTDDSDIYRKAVGWTCDFVG
SYHKYQATNCCFSEDGSLLAVSFEEIVTIWDSETWELKCTFCQRAGKIRHLCFGRLTCSK
YLLGATENGILCCWNLLSCALEWSAKLSVGVMEPDPNSENIAVVSQSPVGSDLFVFKPSE
PRPLYIQKNISREEVQWGVFVPRDVPESFTSEAYQWLNRSQFYFLTKSQSLLTFSTTSPE
EKLTPTSKQLLAEESLPTTPFYFILGKHRQQQQDEKLNKALENELEQLPLTENIPAISEL
LHTPAHVLPSASFLCSMFVNSLLLSTETKSAEEVPDDADMEEEKESDDSDEENNFTEEVQ
DTNTTDLGEDIIHQLSKSEEKELRKLRKVDYSWIAAL
Download sequence
Identical sequences ENSVPAP00000010626 ENSVPAP00000010626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]