SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010714 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010714
Domain Number 1 Region: 3-94
Classification Level Classification E-value
Superfamily FKBP-like 1.22e-38
Family FKBP immunophilin/proline isomerase 0.00000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010714   Gene: ENSVPAG00000011511   Transcript: ENSVPAT00000011510
Sequence length 95
Comment pep:novel genescaffold:vicPac1:GeneScaffold_427:104999:123005:-1 gene:ENSVPAG00000011511 transcript:ENSVPAT00000011510 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRA
KLTISPDYAYGVTGHPGIIPPNATLIFDVELLKLE
Download sequence
Identical sequences ENSVPAP00000010714 ENSVPAP00000010714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]