SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010778 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010778
Domain Number 1 Region: 568-624
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.33e-20
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00011
Further Details:      
 
Domain Number 2 Region: 150-193
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000445
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00061
Further Details:      
 
Domain Number 3 Region: 87-149
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.0000000772
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010778   Gene: ENSVPAG00000011579   Transcript: ENSVPAT00000011579
Sequence length 624
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_253:56919:134464:1 gene:ENSVPAG00000011579 transcript:ENSVPAT00000011579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSTNPGHWVTFDDDPTFQSSQKSKNFPLENQGICRPNGLKLNLSGPKEFPSGSSSTNST
PLSSPITDFYFSPGPPSNSPLSTPTRPDHPHCLSYKLELGSDQEIPSDWYPFATVQFGVL
DTCASQTEVRSLGVESDVQPQKHIHQRACYNVQPKLYSSVIEDVIEGVRDLFAEEGVEEQ
VLKDLKQLWETKVLQSKATEDFFRNSVHSPLVTFQLPHSLHQTLQSSTASLVIPAVRTLP
SFTTAELGTSNSSAHFAFPGYPIHVPAGVTLQTASGHLYKVNVPIMVTQTSGGANILQHP
IQQVFQQLGQPSVIQTSIPQLNPCSLQATTEKSQRMETVLQQPTVLHSGTVERKRVENTT
SDILLHPGNEHKLMSEALPSQLKNSQYIGLPGVVFSPQVFQADSHVEPVLSVFAGMTQNL
HGEPLSTGPQGTQHQHMPDAQLHVLKNRMCGCDSVKQPRDAEEPSSLPVSEKVSNSQMDL
SIQIADDGINEIIQVDGTGDTSSNDEIGSTRDVDENEFLGTIDAGDLKVLEEEADSISSG
DSAADSSDNEDSQIDLVEEDPLNSGDDVSEQDVPDLFDTDNVIVCQYDKIHRSKNKWKFY
LKDGVICFGGRDYVFAKAIGDAEW
Download sequence
Identical sequences ENSVPAP00000010778 ENSVPAP00000010778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]