SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010993 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010993
Domain Number 1 Region: 59-101
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 3.66e-16
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00014
Further Details:      
 
Domain Number 2 Region: 2-25
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000011
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010993   Gene: ENSVPAG00000011813   Transcript: ENSVPAT00000011813
Sequence length 109
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1676:4206:7916:-1 gene:ENSVPAG00000011813 transcript:ENSVPAT00000011813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYQLYRKTTLGNSLQESLDELIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXG
SLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
Download sequence
Identical sequences ENSVPAP00000010993 ENSVPAP00000010993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]