SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000011026 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000011026
Domain Number 1 Region: 167-240
Classification Level Classification E-value
Superfamily Ribosomal protein S7 1.31e-22
Family Ribosomal protein S7 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000011026   Gene: ENSVPAG00000011849   Transcript: ENSVPAT00000011848
Sequence length 241
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2608:180896:184278:1 gene:ENSVPAG00000011849 transcript:ENSVPAT00000011848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAPAGKAARGCSGIELGVRGPVLRLPGLTQVRWSRYGPEYKDPQIDKEYYRKPLAELTEE
EKYERELRKTQLIKAAPAAKTSSVFEDPVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPVPLPDRRRRF
LAMKWMITECRENKHRRMLMPEKLSRELLEAFHNQGPVIKRKHDMHKMAEANRALAHYRW
W
Download sequence
Identical sequences ENSVPAP00000011026 ENSVPAP00000011026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]