SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000011036 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000011036
Domain Number 1 Region: 628-766
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000000217
Family Phosphate binding protein-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000011036   Gene: ENSVPAG00000011860   Transcript: ENSVPAT00000011859
Sequence length 767
Comment pep:novel genescaffold:vicPac1:GeneScaffold_3105:3042:563228:-1 gene:ENSVPAG00000011860 transcript:ENSVPAT00000011859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKVLMQIIHIGAIFQEKVAKDDRAFQLAAPDLSLSDDILQSKITCSFKVIEVNNAFQALQ
EDEKLNTQGMLTMVISTSCASANTLQSLTDVMHVPDLFVQCSPEGSLLTACHLNPIPDGE
VYTLASRPPMRLNDVMLRLVTELCWQKIIMFYDSTYXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXEISDPEILDLVHSALGRMTVVRQIFPSAKDNQKCMRHRISSLLCDLKEGYLQMLQIS
NLYLYDSVLMLANAFHRKLEDRKWHSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XGESSVNSMAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQDLSKQVEVSY
GTVRDSAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGADNCVSSPSEGIRKAKKGNYAF
LWDVAVVEYAALTDDDCSVTVIGNSVSSKGYGIALQHGSPYRDLFSQ
Download sequence
Identical sequences ENSVPAP00000011036 ENSVPAP00000011036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]