SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000011117 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000011117
Domain Number 1 Region: 258-314
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000000000147
Family VPS37 C-terminal domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 2-63
Classification Level Classification E-value
Superfamily UBC-like 0.000000108
Family UBC-related 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000011117   Gene: ENSVPAG00000011946   Transcript: ENSVPAT00000011945
Sequence length 330
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_124:951370:968518:1 gene:ENSVPAG00000011946 transcript:ENSVPAT00000011945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLPPQFPQEKPVISVYPPIQHHLVDKQGVYVTSPLVSNFTMHSDLGKIIQSLLDEFWKNP
PVLAPTSTAFPYLYSNPGGMPPYASQSFPFLPPYPPQEANRTISSLSVADTVSSSTTSYT
TAKPAAPSVGVLSNLPLPVPTTDTSTPISQNGFGYKMPDVPDAFPELSELSVSQLTNMNE
QEELLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDKYELLTQM
KSAFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKTEIDDFLSSFM
EKRTICHCRRAKEEKLQQVIAMHSQFHAPL
Download sequence
Identical sequences ENSVPAP00000011117 ENSVPAP00000011117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]