SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000011118 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000011118
Domain Number 1 Region: 11-203
Classification Level Classification E-value
Superfamily PRTase-like 2.27e-42
Family Phosphoribosyltransferases (PRTases) 0.00075
Further Details:      
 
Domain Number 2 Region: 237-421
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.1e-38
Family Decarboxylase 0.00000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000011118   Gene: ENSVPAG00000011947   Transcript: ENSVPAT00000011946
Sequence length 424
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2247:759812:773309:1 gene:ENSVPAG00000011947 transcript:ENSVPAT00000011946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPEAALTSLVTGLYNVEAFKFGNFVLKSGLSSPDYIDLRGIVSRPRLPSQVAEILFQT
AQNAGINFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGCINPGETCL
IIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGRDRLQAHGIRLHSVCTLSKVL
EILEQQEKVDAEMVERVKRFIQENVFVVTNHNGSLPSVKKAPKELSFGARAELPGIHPVA
SKLLRLMQKKETNLCLSADTAESSELLQLADALGPSICMLKTHVDTLNDFTLDVMKELTT
LAKCHEFLIFEDRKFADIGSTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLP
LHRACLLIAEMSSAGSLATGDYTKEAVRMAEEHSEFVIGFISGSRVSMKPEFLHLTPGVQ
LEAG
Download sequence
Identical sequences ENSVPAP00000011118 ENSVPAP00000011118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]