SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000011368 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000011368
Domain Number 1 Region: 45-236
Classification Level Classification E-value
Superfamily Cytochrome c 4.24e-74
Family Cytochrome bc1 domain 0.00000000746
Further Details:      
 
Domain Number 2 Region: 237-282
Classification Level Classification E-value
Superfamily Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 4.19e-16
Family Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.000099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000011368   Gene: ENSVPAG00000012230   Transcript: ENSVPAT00000012228
Sequence length 282
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3021:186:1643:1 gene:ENSVPAG00000012230 transcript:ENSVPAT00000012228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVFLSSKSGLSRGRKVILSALGMLAAGGAGLAVALHSAVSASDLELHAPSYPWSHRGLLS
SLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDEAKALAEEVEVQDGPNEDGE
MFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYIFSLLTGYCEPPT
GVSLREGLHFNPYFPGQAIAMAPPIYTEVLEFDDGTPATMSQVAKDVCTFLRWASEPEHD
HRKRMGLKMLMMMGLLLPLVYAMKRHKWSVLKSRKLAYRPPK
Download sequence
Identical sequences ENSVPAP00000011368 ENSVPAP00000011368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]