SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000011475 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000011475
Domain Number 1 Region: 208-636
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 1.68e-169
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000241
Further Details:      
 
Domain Number 2 Region: 1-207
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 1.7e-68
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000011475   Gene: ENSVPAG00000012344   Transcript: ENSVPAT00000012344
Sequence length 660
Comment pep:known_by_projection scaffold:vicPac1:scaffold_5549:32118:56455:-1 gene:ENSVPAG00000012344 transcript:ENSVPAT00000012344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATL
TTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLFNYINPHNGKHSPMVAKPTLDIVLAN
KDRLNSAIIYDRDFSYNYFGFKTLERSYLLKINGKVAERPQHMLMRVSVGIHKEDIDAAI
ETYNLLSEKWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCALISKSAGG
IGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRPGAFAIYLEPWHLD
IFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSLMCPNECPGLDEVWGEEF
EKLYESYEKHGRVRRVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNLGTIKCSN
LCTEIVEYTSKDEVAVCNLASLALNMYVTSEHTYDFMKLAEVTKVIVRNLNKIIDINYYP
VPEASVSNKRHRPIGIGVQGLADAFILMRYPFESPEAQLLNKQIFETIYYGALEASCDLA
KEYGPYETYEGSPVSKGILQYDMWNVTPTDLWDWKLLKEKIAKYGIRNSLLIAPMPTAST
AQILGNNESIEPYTSNIYTRRVLSGEFQIVNPHLLKDLTERGLWNEEMKNQIIACNGSIQ
Download sequence
Identical sequences ENSVPAP00000011475 ENSVPAP00000011475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]