SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000000424 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000000424
Domain Number 1 Region: 2-567
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 1.18e-82
Family Acetyl-CoA synthetase-like 0.0000323
Further Details:      
 
Domain Number 2 Region: 753-1096
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 8.44e-48
Family Quinoprotein alcohol dehydrogenase-like 0.0085
Further Details:      
 
Domain Number 3 Region: 551-631
Classification Level Classification E-value
Superfamily ACP-like 0.000013
Family Acyl-carrier protein (ACP) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000000424   Gene: ENSVPAG00000000454   Transcript: ENSVPAT00000000454
Sequence length 1097
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_810:174728:197788:-1 gene:ENSVPAG00000000454 transcript:ENSVPAT00000000454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQELVHQAACLYSDKTAVCFDECNNQPPVYYTYKTVVNTASELSHFLLLHCDFQGIRE
IGLYCQPGINLPSWILGILQVPAAYAPIDPDSPPALSVHFIKKCDLKYVLVEKQQINKFK
SSFETLLNYDTFTVEHNDLVLFRLHWENEVSLTLNDRKEKCEKGKMTKSMNSENRTEEKS
DEHMDVRLQHCLAYVLHTSGTTGTPKIVRVPHACIVPNIQHFQVLFEITHEDVLFLASPL
TFDPSVVEIFVALSSGASLLIVPTSVKVLPSKLAALLFSHHRVTILQATPTLLRRFGSQL
IKSTVLSANTSLRVLALGGEAFPSLTALKSWREVGNKTQIFNVYGITEVSSSTTLELPEK
ILNSTLKCELPVQLGFPLLGTVVEVRDTNGFTIQEGIGQVFLGGRYRVCFLDDEVTVPLG
TMRATGDFVTVKDGEIFFLGRKDSQIKRHGKRLNVELVQQIAEGLQEVESCAVTWYNQEK
LILFMVSKKDLVKDCIFKELQKHLPSHAIPDELVLIDSLPLTSHGKIDVSELNKIYLNYI
NLKSEWKLNGKDELWEKLQHLWKSVLNFSEDPLKVPNESLFLNSGGDSLKSVRLLSEIEN
LVGTSVPGLLEIILSSSILEIYNHILQTVFPDENPTFIKNYATKRKLNDVNQEENNGKSL
RQESIMSLKCDSEINAFIALSRGSQILSLNTTRFLTTLEHCPSACSSDLISQTNIQNTKS
LNPPALIGTSKDPSCIAKVPEEETPVMGAEKMEFRVRWRSDTGKCVDASPLVVIPAVDKS
SATVYIGSHSHRMMAVDLYSGKVKWEQTLGDRIESSACVSKCGNFVVVGCYNGLVYVLKS
NSGEQYWMFTTEDAVKSSATMDPTTGLLYIGSHDQHAYALDIYKKKCVWKLKCGGTVFSS
PCLSLIPHHLYFATLGGLLLAINPATGNRVWEYSCGKPLFSSPQCCLQYICIGCVDGNLL
CFTHFGEQVWKFSTNEPIFSSPCTSASEQEIFFGSHDCFIYCCSMKGHLQWKFETTSRVY
STPFAFHNHNRSNEMLLAAASTDGKLWILESKSGQLQSVYQLPGEVFSSPVVWESMLIIG
CRNNYVYCLDLLSGKQK
Download sequence
Identical sequences ENSVPAP00000000424 ENSVPAP00000000424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]