SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000003508 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000003508
Domain Number 1 Region: 2193-2385,2438-2621,2656-2711
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.45e-110
Family DNA polymerase I 0.00000096
Further Details:      
 
Domain Number 2 Region: 408-488,523-616
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.77e-37
Family Tandem AAA-ATPase domain 0.00041
Further Details:      
 
Domain Number 3 Region: 846-963
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 3.14e-35
Family Achaeal helicase C-terminal domain 0.003
Further Details:      
 
Domain Number 4 Region: 198-405
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.99e-21
Family Tandem AAA-ATPase domain 0.00079
Further Details:      
 
Domain Number 5 Region: 2024-2157
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000262
Family DnaQ-like 3'-5' exonuclease 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000003508   Gene: ENSVPAG00000003779   Transcript: ENSVPAT00000003779
Sequence length 2715
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3642:1738540:1851999:-1 gene:ENSVPAG00000003779 transcript:ENSVPAT00000003779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INRHPFKSRIHFILPCQKIEHRSINELLAQNDHSGTSRTPSKPFTTEVYRPAVPKTPSHV
LHSVWLKNLGTKTALPYHHTPGKLRFINFENWREDGGRICQQARFLQNRRTLGLYLSLKS
REDFAMNLTRWSGKRRRSASGSDSFSGSGGDSSDNLLLPSGPVLSPPPGLGRSLKAAAAG
ECKQIFPDDHTDRLLLANWGLPTAVLEKYHSFGVQKMFEWQAECLLLGRVLEGKNLVYSA
PTSAGKTLVAELLILKRVLEMRKKALFILPFVSVAKEKKYYLQXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMVVVDELHMLGDSHRGYLLELLLT
KICYIAQKSASCQADLASSLASAVQIVGMSATLPNLELVASWLNAELYHTDFRPVPLLES
VKIGNSIYDSSMKLVREFQPMLQVKGDDDHVVSLCYETVLDNHSVLLFCPSKKWCEKLAH
VIAREFYNLRHQAEGKAGVVRSSELPPMILERKGLLEVMDQLKRVPSGLDSVLQKTVPWG
VAFHHAGLTFEERDIIEGAFRQGQIRVLAATSTLSSGVNLPARRVIIRTPIFSGQPLDIL
TYKQMVGRAGRKGVDTVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXFFTSLVLLDLISEVPLKEINQKYGCNRGQIQSLQQSAAVYAGMITVFSNRLGWH
NMELLLSQFQKRLTFGVQRELCDLVRISLLNAQRARFLYASGFLTVADLARADVAEVETI
LKKAVPFISTRKAVDEEEEAAEERRNMRTIWVTGRKGLTEREVAALIVEEARMILQQDLI
EMGVQWNPYSLSNSDTHSLISSKSEVKEHKFIPQIESSYKRVTAKRKSNTVFSDSSVNDS
PNTVHDLDKSTEGTNFFSHKFQVGNQEHQLHCITRTRKQASLNINKKNLGTSLREGKTSS
KKVVQTLSSEKTKKEALNFSSEKMNTTSQSWKHNNKHLKLSRDNSPIKDTRIHRINLQER
AMSNPVHCEDSFTLIENMEFRSPEPFAKNVSFCAEGKYNKTLFLSQTEQSCLRNETIAND
ILVEHFIAGSQSKKVICQDAKVVSENGRELAIESEKINKAWIQNESKNHNVCVKHYDSHP
GNCLEKQFDKQANTYTKLKKITAIQMPCETDCSYMNRDSTVIVRRESVKFNAEENKSNNL
QVSEDNTSITEIPSGVHLPSRACGKSGGQPENILNTPRVQEKTDAYAAVKAKNDHVSDLG
LDLCDFEDSLYLDTQSEKIIQQVATENAKQERVKDTNLATGMMQKSLDKQSSMSSCQNEI
HITFPRERCSSGMTNTDHLKLKTVDAVKQSTDSRGVDNLTPESPTLYSPTLVGENGPCFK
GNELSVTDSQLNSFLQGYQTQEAMKPVIPLFPQKRTPTGIEVECLPVPETSLNLSDSLLF
DSFSEDDLIKEQPPDVRAKELPLEIASVHFSDSLCFQPEGPIKKSNMIENQDNQQPLSCF
SGGSIIFSEIDSAQMVEALDNVDVSPVQEKHNTTVSLRILELSDPVIEGNDYPQREVIGG
VKDERSQKSKLTGMRQENSFVWSGASFDLSPGLQRILDQVPSPLENEKLKLTTTDLSLLK
GKNTTVNDKQELISNLEPNQVQISFSPNIAVKGKIALENVIHGEIPLLXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDESLFCTSDNKNHDLSPERNGLKDS
SPIRDTSFSLQLSRDGLQLTPASCSSESLAIIDVASDQTLFQTFIKEWQSKTRFSISLAC
EKISNLTSSKTTTIGGRFKQVRSPQENPIRDDGFPVKGCDDILVVGLAVCWGGRDAYYFS
LQREQKHSEITASLAAPSLDPSLTVKDRMWHLQSCFRKESDKERSVIIYDFIQSYKILLL
SCGISLEQSYEDPKVACWLLDPDSKEPTLHSIISRFLPHELPLLEEIETGQGIQSLGLNV
STEHSGRYRASVESILIFNSMNQLSSLLKKENLQDVFCKVEMPSQYCLALLELNGIGFST
AECESQKHLMQAKLDAIETQAYQLAGHSFSFTSSDDIAEVLFLELKLPPSGERKNQGSKK
TLGSTRRGIDNGHKQRLGKQFSTSKDVLNKLKAIHPLPGLILEWRRITNAITKVVFPLQR
EKRLNPFLGMERIYPVSQSHTATGRITFIEPNIQNVPRDFEIRMPTLVEESPPSQALGKG
LLPTSRRGKKKGCGLNRRHQAQMGERASDRGMPFSVSMRHAFVPFPGGLILAADYSQLEL
RILAHLSHDHRLIQVLNTGADVFRSIAADWKMIEPGSVGDDLRQQAKQICYGIIYGMGAK
SLGEQMGIKENDAACYIDSFKTRYTGINHFMRETVKNCKRDGFVQTILGRRRYLPGIKDN
NPYRKAHAERQAINTTVQGSAADIVKIATVNIQKQLETFHSTFKSHGHREGMLQNDRTVG
LLPKRKLQGMFCPIRGGFFILQLHDELLYEVAEEDVVQVAQIVKNEMESAVKLSVKLKVK
MKIGASWGELKDFDV
Download sequence
Identical sequences ENSVPAP00000003508 ENSVPAP00000003508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]