SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000004369 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000004369
Domain Number 1 Region: 588-663
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 2.62e-28
Family AN1-like Zinc finger 0.00001
Further Details:      
 
Domain Number 2 Region: 1-42
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000921
Family Ubiquitin-related 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000004369   Gene: ENSVPAG00000004711   Transcript: ENSVPAT00000004711
Sequence length 668
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2822:106632:140186:-1 gene:ENSVPAG00000004711 transcript:ENSVPAT00000004711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPMCQQHLIWNNMELEDDYCLNDYNISEGCTLKLVLAMRGGPINTRRVPMEDPLREMAEY
MDSSRDEVWEKTSSTKQVTFLVYREGDQLNFFRVVDRGDGTLTPLSESLRIGFHLHVRNE
HCMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKKAVKV
KPCPPVAPRPSSGSTAAARRRLLRALPHIGQSCLPSPGNTCLPASISNAISSLATLPPAD
RPMSSIASDFLKEDDTWESNALSHSNGSFKLSPPQIPLMEFKNDKELADSVLHLGSSLPR
RTKHFAGNLSSNNEDDPALFPPSEEHVTEESLLPEVDSFASFTEGNTDKQSSGLEGTRKG
NPEFLLTNGDKGLKATEKHLKHIARVLSGELVETTVLNHRELSPHKNRLLSPLRCSAPTS
LHNSLVKPQRQSKCFDSGNLQSSASQNALRSLDVRNISDSSFSRTTRFRAVKVDSPGKRA
DTISKVEARDITEMANKASKEPVGCVNNIGLLASLARSASRDGLQSTRGAGRLRTSGAGL
STNLQHFQGESLRKSSPQLEPTEFFLSARGTGMNGNNTAAGKRVGECTHHLPPVKAPIQT
KKKTTKHCFLCGKKTGLATSYECRCGNNFCASHRYAEAHSCTYDYKSAGRRYLQEANPVV
NAPKLPKI
Download sequence
Identical sequences ENSVPAP00000004369 ENSVPAP00000004369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]