SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000006548 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000006548
Domain Number 1 Region: 296-508
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 4.06e-75
Family Cryptochrome/photolyase FAD-binding domain 0.0000155
Further Details:      
 
Domain Number 2 Region: 22-202
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 1.03e-54
Family Cryptochrome/photolyase, N-terminal domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000006548   Gene: ENSVPAG00000007039   Transcript: ENSVPAT00000007039
Sequence length 593
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_1111:136249:167395:1 gene:ENSVPAG00000007039 transcript:ENSVPAT00000007039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAVATAAAAAPAPAAGAEGATSVHWFRKGLRLHDNPALLAAVRGAHCVRCVYILDPWF
AASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYD
SEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQAIISRME
LPKKPVGSVTSQQMESCRAEIQENHDETFGVPSLEELXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKRNST
PPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWID
AIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLS
CSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCI
IGVDYPRPMVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLSNPVAEPSSSQ
AGSMSSAGPRPLPGGPASPKRKLEAAEEPPGEELSKRARVAELPSTELPGRDV
Download sequence
Identical sequences ENSVPAP00000006548 ENSVPAP00000006548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]