SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000007946 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000007946
Domain Number 1 Region: 196-489
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 4.58e-98
Family Cryptochrome/photolyase FAD-binding domain 0.0000151
Further Details:      
 
Domain Number 2 Region: 5-214
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 2.09e-54
Family Cryptochrome/photolyase, N-terminal domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000007946   Gene: ENSVPAG00000008541   Transcript: ENSVPAT00000008540
Sequence length 587
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_871:335136:414259:-1 gene:ENSVPAG00000008541 transcript:ENSVPAT00000008540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLE
DLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEA
GVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEIPVETITSEVIEKCTT
PLSDDHDEKYGVPSLEELGFDTDGLPSAVWPGGETEALTRLERHLERKAWVANFERPRMN
ANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAA
TNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHA
VACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGR
RTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLN
IERMKQIYQQLSRYRGLGLLASVPSNPNGNGSLMGYSPGENIPGCSSSGSCTQGSSILHY
AHGDSQQAHLLKQGKSSTGTGLSSGKRPSQEEDMQSIGSKVQRQSTN
Download sequence
Identical sequences XP_006205926.1.17985 ENSVPAP00000007946 ENSVPAP00000007946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]