SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000009452 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000009452
Domain Number 1 Region: 273-370
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000000808
Family N-acetyl transferase, NAT 0.0000397
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000009452   Gene: ENSVPAG00000010159   Transcript: ENSVPAT00000010159
Sequence length 376
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_2119:116758:137902:-1 gene:ENSVPAG00000010159 transcript:ENSVPAT00000010159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQSGLGQPVLSQPDTNQLGMNQSITSLPDINQPGVRQPGMSQLSRSQPDTNQQGMKQPGM
WQSGPCQISTRQPGTWQQGRSQSIMTQPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSFRVRPAEAQDCLEILRLIKELAACENMV
DAVKLTAKDLLRDGFGENPLFYCLIAEVHTHQKPTSKVTVGFAMYYFTYDPWIGRLLYLE
DFYVIQAYRDSHQKPM
Download sequence
Identical sequences ENSVPAP00000009452 ENSVPAP00000009452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]