SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSVPAP00000010565 from Vicugna pacos 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSVPAP00000010565
Domain Number 1 Region: 252-344
Classification Level Classification E-value
Superfamily TAFH domain-like 5.75e-33
Family TAFH domain-like 0.0000308
Further Details:      
 
Domain Number 2 Region: 653-701
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000126
Family TBP-associated factors, TAFs 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSVPAP00000010565   Gene: ENSVPAG00000011346   Transcript: ENSVPAT00000011346
Sequence length 856
Comment pep:known_by_projection genescaffold:vicPac1:GeneScaffold_3449:1183899:1295401:1 gene:ENSVPAG00000011346 transcript:ENSVPAT00000011346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPAGLTEPAGAAPTAGVGASGTVTMAPAAALPVRVESTPVALGAVTKAPVSVCVESVASQ
PLRSPVGTLVTKVAPTNALPKLSSGPRLPAPQIVAVKAPNTTTIQLPANLQLPPXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSSSQLIKKVAVAPVKP
LAPIGTTVVTTVPKPSSVQSVAVPTNVVTVTPVKPLNTVTTLKPSSLGAPSIPSNEPHPK
AENSAAAQTNLSPTMLENVKKCKNFLAMLIKLACSGSQSPEMGQNVKKLVEQLLDAKIEA
EEFTRQLYVELKSSPQPHLVPFLKKSVIALRQLLPSSQSFIQQCIQQTSGEVVIAACTTT
VTASPVVTTAVASVQPEKPAIGSEAATPGTVSVQTLNPLAGPGGAKTGVVTLHSVGPAAV
PAGTTAGTVVLQAPKPLVTSLPNTVTAVSLQPEKPVVSGAAVTLALPSVTFGETSAAAIC
LPSVKPVVTSAGXXXXXXXXXXXXXXXLAQPGPILAQPAGVPQAVKVKQLVVQQPSGGLA
KQVTTLSHSSALTIQKSGQKKVIVSPAVPTSQFPQASILKQITLPGNKILSLQSSMQKNK
VKENGSTSFRDEDDINDVTAMAGVSLSEENACILATNSELVGSLVQSCKDEPFLFIGALQ
KRILDIGKKHDITELNSDAVNLISHATQERLRGLLEKLTTIAQHRMTTYKASENYILSND
TRSQLKFLEKLDQLEKQRKDLEEREMLLKAAKSRSNKEDPEQLRLKQKAKEXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXGKDNLFASGASSLTATKQLLRTRITRGLRLLCME
QEREMKYSRALYLALK
Download sequence
Identical sequences ENSVPAP00000010565 ENSVPAP00000010565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]