SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|471269075|ref|YP_007651540.1| from Xanthomonas citri subsp. citri Aw12879

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471269075|ref|YP_007651540.1|
Domain Number 1 Region: 10-371
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 4.45e-104
Family FMN-linked oxidoreductases 0.00000000565
Further Details:      
 
Domain Number 2 Region: 342-528
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 7.42e-41
Family N-terminal domain of adrenodoxin reductase-like 0.0000116
Further Details:      
 
Domain Number 3 Region: 469-527,563-657
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.16e-19
Family C-terminal domain of adrenodoxin reductase-like 0.0000955
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|471269075|ref|YP_007651540.1|
Sequence length 679
Comment NADH:flavin oxidoreductase, Old Yellow Enzyme family [Xanthomonas citri subsp. citri Aw12879]
Sequence
MSPATGPSALSFPHLFTPLDLGFTQLRNRVLMGSMHTGLEDRARDFPKLAAYFAERAAGG
VGLIVTGGFSPNVVGWLKPFGGKLSWPWEVRPHRQVTRAVHEHGAKICLQLLHAGRYAYH
PLSVAPSRLKAPINPFTPRALSAGAVDRQIAAYARAARLAREAGYDGVEVMGSEGYLINE
FTAARTNRRSDAWGGDASKRMRFAVEIVRRIREACGPDFIIIYRLSLVDLVEDGNQWQEI
LAQAQAIEAAGATIINSGIGWHEARIPTIATSVPRAAFAGVTAKLKPHLRIPVVATNRIN
MPEVAERILADGAADMVSLARPLLADPQWTNKARAGQSHTINTCIACNQACLDHVFDNKL
ASCLVNPRAAHETELNYTPTATPKRIAVVGAGPAGLACATVAAERGHRVTLFDASDAIGG
QFNVARRIPGKEEFNETLRYFGHRIEATGVQLRLNTPVQAADLKDFDEVVLATGIEPRKV
DFPGADHPMVVSYLDVVLGRHVAADKVAIIGAGGIGFDVGEFLVHTGQSPSLDPQRWMAE
WGVDPSFEARGALNKPQPERAARQVWLLQRSPGKPGGRLGKTTGWIHRATLKAKGVKMLG
GVEYLGVDDAGLRIRVEGSEQLLDVGTVVVCAGQEPRRELLAALQANGQQPHLIGGADVA
AELDAKRAINQASRLAATL
Download sequence
Identical sequences A0A0U5F9J9 A0A1T1S358 M4TR06 Q8PNP4
190486.XAC1010 WP_005932206.1.101581 WP_005932206.1.13350 WP_005932206.1.14945 WP_005932206.1.21004 WP_005932206.1.22109 WP_005932206.1.28779 WP_005932206.1.31392 WP_005932206.1.38217 WP_005932206.1.39696 WP_005932206.1.43799 WP_005932206.1.43832 WP_005932206.1.47697 WP_005932206.1.47707 WP_005932206.1.53417 WP_005932206.1.56804 WP_005932206.1.58382 WP_005932206.1.61945 WP_005932206.1.62531 WP_005932206.1.6260 WP_005932206.1.63386 WP_005932206.1.6829 WP_005932206.1.70193 WP_005932206.1.71126 WP_005932206.1.71284 WP_005932206.1.72810 WP_005932206.1.76206 WP_005932206.1.79813 WP_005932206.1.79879 WP_005932206.1.80421 WP_005932206.1.80602 WP_005932206.1.87455 WP_005932206.1.88516 WP_005932206.1.88706 WP_005932206.1.88988 WP_005932206.1.89206 WP_005932206.1.90138 WP_005932206.1.90200 WP_005932206.1.92002 WP_005932206.1.92041 WP_005932206.1.92912 WP_005932206.1.94705 gi|470470934|ref|YP_007635502.1| gi|471269075|ref|YP_007651540.1| gi|21241775|ref|NP_641357.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]