SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|471268900|ref|YP_007651365.1| from Xanthomonas citri subsp. citri Aw12879

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471268900|ref|YP_007651365.1|
Domain Number 1 Region: 9-300
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 3.27e-80
Family ADP-ribosylglycohydrolase 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|471268900|ref|YP_007651365.1|
Sequence length 305
Comment ADP-ribosylglycohydrolase [Xanthomonas citri subsp. citri Aw12879]
Sequence
MTHGDLERARFRGCLLGLAVGDALGTTLEFCAPGSFTPIDDMRGGGPFALRAGQWTDDTS
MALCLAHSLLHRQGFDAADQMNRYCNWYQHGYLSSTGHCFDIGNTVRQALERYLDGGPAF
SGSADPRAAGNGSLMRLAPVAMYYAHRPDELAERAADSSRTTHASAEALDACRLFAFQLR
AALLGNARDQVLHAQPEALLTPAVHVLAIRDHVSVPAARIRGTGYVIDSLSAALWCFATT
DSFDEAVLRAANLGDDADTTAAICGQLAGAFYGIEGIPAAWRERVQDAAEIVVLADRLYE
AGQVA
Download sequence
Identical sequences A0A0U5BVP1 A0A1T1S9H4 M4TWV0 Q8PHZ3
gi|470472974|ref|YP_007637542.1| WP_011052039.1.101581 WP_011052039.1.13318 WP_011052039.1.13350 WP_011052039.1.14945 WP_011052039.1.18336 WP_011052039.1.19505 WP_011052039.1.21004 WP_011052039.1.22109 WP_011052039.1.28779 WP_011052039.1.30380 WP_011052039.1.30778 WP_011052039.1.31392 WP_011052039.1.3308 WP_011052039.1.35047 WP_011052039.1.35540 WP_011052039.1.37228 WP_011052039.1.38217 WP_011052039.1.39696 WP_011052039.1.41216 WP_011052039.1.41431 WP_011052039.1.42745 WP_011052039.1.43799 WP_011052039.1.46272 WP_011052039.1.47697 WP_011052039.1.53417 WP_011052039.1.56030 WP_011052039.1.56391 WP_011052039.1.56804 WP_011052039.1.58382 WP_011052039.1.60328 WP_011052039.1.61945 WP_011052039.1.62531 WP_011052039.1.6260 WP_011052039.1.63386 WP_011052039.1.6829 WP_011052039.1.70026 WP_011052039.1.70193 WP_011052039.1.71126 WP_011052039.1.71284 WP_011052039.1.72810 WP_011052039.1.79879 WP_011052039.1.80421 WP_011052039.1.80602 WP_011052039.1.82073 WP_011052039.1.87455 WP_011052039.1.88516 WP_011052039.1.88706 WP_011052039.1.88988 WP_011052039.1.89206 WP_011052039.1.90138 WP_011052039.1.90200 WP_011052039.1.90226 WP_011052039.1.92002 WP_011052039.1.92041 WP_011052039.1.94705 WP_011052039.1.96706 WP_011052039.1.99816 gi|21243832|ref|NP_643414.1| XaR39 gi|471268900|ref|YP_007651365.1| 190486.XAC3105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]