SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|471269554|ref|YP_007652019.1| from Xanthomonas citri subsp. citri Aw12879

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|471269554|ref|YP_007652019.1|
Domain Number 1 Region: 243-287,320-571
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 3.77e-42
Family CoA transferase alpha subunit-like 0.03
Further Details:      
 
Weak hits

Sequence:  gi|471269554|ref|YP_007652019.1|
Domain Number - Region: 34-135,162-279
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 0.000823
Family CoA transferase alpha subunit-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|471269554|ref|YP_007652019.1|
Sequence length 671
Comment Acetyl-CoA hydrolase [Xanthomonas citri subsp. citri Aw12879]
Sequence
MAHEYEMQAARDRLGYSARMTEHLTDLSAAVERILQRIDGPLRVGAPLGIGKPHRLLNAL
YAQLKDTPSRPLAIYTALSLNPPRPDAGLQARFAAPFIARHFGEDFPRLAYVDAMLRDAL
PTHVQVEEFYMQSGGLLHSAQAQADYTSLNYTHAAAAVAQRAPNLIVQKVAREPGGTRLS
LSCNNDITQDTLDAVQALGLPRPMLVAEVDPQLPWMGGAAAVDAAFFDLIIDLPGPFPQL
FGLPRQAVNSVDYAIGLYASALVRDGGTLQIGIGTLADALSHALVLRHTDNATYRRVLHA
LDPALEQHPAVQSSGGLEPFAIGLYGCSEMLNEGFKQLVDSGVIRRKVHDDLPLMQRIAD
GSADAADHARLAAEGEFLHGAFYLGSPAFYQWLRDLDASTRAAIGMRRISEINQLYGGNE
TLNRLKRKDARFFNSCMMATALGAAVSDGLEDGRIVSGVGGQYNFVAMAHALPQARSALM
LRATREAGAHTASNLRWNYGHTTIPRHLRDLYITEYGIADLRHKTDQDCVLEMAAICDAR
FQDELLAQAERSRKLRIAPELPPRAQRNTPRALEQALAPFRRDGSLPDYPLGSDFTKIEQ
RLLPALGWLKGATASTGGKIATVARALLTREASDANEIDCLQRMALDAPNSLGDRLQARL
LTYALRRTATS
Download sequence
Identical sequences A0A0U5FH99 M4TXV4
gi|471269554|ref|YP_007652019.1| gi|470473235|ref|YP_007637803.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]