SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|27364098|ref|NP_759626.1| from Vibrio vulnificus CMCP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27364098|ref|NP_759626.1|
Domain Number 1 Region: 4-170
Classification Level Classification E-value
Superfamily MtlR-like 7.59e-57
Family MtlR-like 0.00000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|27364098|ref|NP_759626.1|
Sequence length 176
Comment mannitol repressor protein [Vibrio vulnificus CMCP6]
Sequence
MAEHTNESDIIERLNHAPSVRGFFVETVDILTEAVDGLVQRIFRKDNFAVQSVVGPLLQD
SGPLGDVSVRLKLLFGLGVLSDHHYHDIEDIIKLKNKLNSDSTEYEFTDPQILEPIKKLH
LVQKMGMVQLEVDDPDDDIELSFYQLQLQRKQQIIRSGLSLAIVEICHELGKDSPF
Download sequence
Identical sequences A0A1W6M0W8
gi|27364098|ref|NP_759626.1| 216895.VV1_0640 WP_011078720.1.16238 WP_011078720.1.17874 WP_011078720.1.34622 WP_011078720.1.54486 WP_011078720.1.81460 WP_011078720.1.93668 WP_011078720.1.9921 WP_011078720.1.99976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]