SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27366145|ref|NP_761673.1| from Vibrio vulnificus CMCP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27366145|ref|NP_761673.1|
Domain Number 1 Region: 119-250
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 5.63e-32
Family Flavohemoglobin, C-terminal domain 0.026
Further Details:      
 
Domain Number 2 Region: 4-110
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 3.57e-26
Family Ferredoxin reductase FAD-binding domain-like 0.0026
Further Details:      
 
Domain Number 3 Region: 238-345
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.7e-24
Family 2Fe-2S ferredoxin-related 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|27366145|ref|NP_761673.1|
Sequence length 347
Comment NADH oxidoreductase hcr [Vibrio vulnificus CMCP6]
Sequence
MFFEWQGNEPATLQCVDKFFETDDTVSIRLADLTESLLFQFKPGQFVNLGVEIDGKMEFR
AYSISSLAGEEYLQFTIKRVEGGKVSNFIIDSLLIGDTVQALAPAGEFNCVDHPPRELDG
QGKALLISAGCGVTPVFAMAKHWLNNEMNVDIEFLHIARSAQETIYFDHLSTCQSAYAHF
HLKLLLKDAQGTTHPQGRFNAQWLQDLVPDFATRTIYLCGPNQFMQDTQDYLQALGFDMN
HFYHESFTPEKVEAMEASDEEVCISVPDFAQTINAKKGQLLADVLENAGLPLIVACRSGI
CGSCKCKVANGQVRSISQETLTTEEIAQGYVLACSSHIESDLEVCLH
Download sequence
Identical sequences WP_011080688.1.17874 216895.VV1_2865 gi|27366145|ref|NP_761673.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]