SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27366659|ref|NP_762186.1| from Vibrio vulnificus CMCP6

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27366659|ref|NP_762186.1|
Domain Number 1 Region: 18-92
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 4.56e-17
Family YbcJ-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|27366659|ref|NP_762186.1|
Sequence length 184
Comment hypothetical protein VV2_0204 [Vibrio vulnificus CMCP6]
Sequence
MSQEHLSQDHEYEEEQFGEEIEIEAIGVEVSVQPIELYKVFKIANLVSGGGEAKHVIAEG
YVAVNGELETRKRRKMYDGDFFEFNQEYYVVVCDAPVTEPETEQEKAEKKTQKQAQAARK
EKSRQSKNAKPKGTGPKSTGRKAAHKERKAQKEALSQSAKKGQKAEKPQATRDPKSGRNS
IDFF
Download sequence
Identical sequences A0A0H0XWV7 A0A1W6MA40 Q7MEF9
196600.VVA0711 216895.VV2_0204 gi|37676371|ref|NP_936767.1| gi|27366659|ref|NP_762186.1| WP_011081183.1.100126 WP_011081183.1.16238 WP_011081183.1.17874 WP_011081183.1.33883 WP_011081183.1.34622 WP_011081183.1.54486 WP_011081183.1.54858 WP_011081183.1.59022 WP_011081183.1.66581 WP_011081183.1.78369 WP_011081183.1.79678 WP_011081183.1.81460 WP_011081183.1.81555 WP_011081183.1.8292 WP_011081183.1.89979 WP_011081183.1.90288 WP_011081183.1.93668 WP_011081183.1.99976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]