SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for sp|A7THG7|LKHA4_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  sp|A7THG7|LKHA4_VANPO
Domain Number 1 Region: 249-491
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.15e-64
Family Leukotriene A4 hydrolase catalytic domain 0.000000269
Further Details:      
 
Domain Number 2 Region: 43-243
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 8.89e-45
Family Leukotriene A4 hydrolase N-terminal domain 0.0000324
Further Details:      
 
Domain Number 3 Region: 499-654
Classification Level Classification E-value
Superfamily ARM repeat 8.06e-38
Family Leukotriene A4 hydrolase C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) sp|A7THG7|LKHA4_VANPO
Sequence length 656
Comment Leukotriene A-4 hydrolase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1039p41
Sequence
MLSQFTRSLSCFVKPTPPKLNKLTRTMTVLPKILQDARPKVSPELDYSTYSNYQNFKINH
TDLNLNISFDDSIVNGFVTFNLNKIDKSCNEIRLDTSFLTVDSVEIDDAKVDFQLKDRLE
PLGSQLIINPPTATSLNNEFNLKLGFSTTKDCTALQWLNGEQTSSGKPYVFSQLEAIHAR
ALFPCFDTPSVKSTFNAAITSTLPVVFSGIEQSVVDNGNGTKTYNFKQSVPIPAYLIGIA
SGDLVSGEIGPRSKVYTEPFRLKDCEWEFSGDVEKFIQAAEKIIFPYEWGTYDILVNVNS
YPYGGMESPNMTFATPTLIAYDKSNIDVIAHELAHSWSGNLVTNCSWNHFWLNEGWTVYL
ERRIVAAIHGEATRHFSALIGWNDLANSISAMKNPDRFSTLIQNLNDGTDPDEAFSSVPY
EKGFNLLFHLETILGGPKEFDPFIKHYFTKFSKKSLDSYQFFDTLFEFFADKREILDAVD
WETWLYKPGMPPKPKFITTLADNVYSLAEKWATEIKNGNTTEDDLKQAFTAADIKDFNSN
QIVLFLDTLVQNKEIQWNNHHTAAKTLLKIYEDSIVKSRNAEVVFRTYRFEITAQLKESY
PQLAEWLATVGRMKFVRPGYRLLNSVDRPLALATFEKLQNIYHPICKALVKQDLEA
Download sequence
Identical sequences A7THG7
436907.A7THG7 XP_001646149.1.22633 sp|A7THG7|LKHA4_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]