SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for sp|A7TSL2|PMIP_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  sp|A7TSL2|PMIP_VANPO
Domain Number 1 Region: 86-765
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.85e-133
Family Neurolysin-like 0.00000297
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) sp|A7TSL2|PMIP_VANPO
Sequence length 787
Comment Mitochondrial intermediate peptidase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=OCT1
Sequence
MQNKVLRGILFKNVPLGYSYNRSIRHPTFGNSIIRWASTQVKTSSDVLQRSFDDHLYWTE
INKQNYSSKEGWGSITKRLKGNKLTTNRSGLFNNEYLTSPEGLKLFSQVSLEKSQKIVDK
LRSDRTPEGLRLYVQNLDLLSDTLCRVIDLCEFIRSSHPDYKFVEAAQDCYEEMFEFMNM
LNTDVNLCFTLKHVLENKEIASKLSEEELRVGRILLEDFEKSGIYMKPEVREQFITLSQS
ISVIGQEFISNTDFVKDNNVVVSCNQLDSLGIDPELLSQIEKDIAGKNYKIPTYGYIPFA
LLKSCPSEEIREKIWVAVHNCSNEQIKRLTDLVKLRAVLSQLLGKKSYAEYQLEGKMAKN
PKEVIEFIKTLMDFTKPMAAKELDGIAEKKLTIKSNGSNLSVCDILKTVRPWDRDYYSAI
EREQTSAKNLYGSEEVLKYFTLGNVMQGLSNLFQKIYGIKLELDVPKIGETWSPEVRKIN
VISEDEGLIGIIYCDLFERSGKTSNAAHFTICCSRDISPYETEDSTTQIAIDSKGTRFQL
PIISLVCNFSKTMISETDSVCFLHLPEVETLFHEMGHAMHSMLGRTKLQNISGTRCATDF
VELPSILMEYFARDPRVLETIGKHYLTKETVKREMLEPHLQDLKYLQHCETYSQAKMAML
DQTLHGETISSHLDHLDVVKLYQDLERQLGVLVDDKSNWCGKFGHLFGYSAVYYSYLFDR
AIASKIWGALFERNPFSRASGDKYRNSVLQWGGSRDPWHCIASALDKPELAKGDDEAIKY
IGSTNQL
Download sequence
Identical sequences A7TSL2
sp|A7TSL2|PMIP_VANPO 436907.A7TSL2 XP_001642605.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]