SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TDK5|A7TDK5_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TDK5|A7TDK5_VANPO
Domain Number 1 Region: 1-219,1095-1187
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.01e-41
Family ABC transporter ATPase domain-like 0.00089
Further Details:      
 
Domain Number 2 Region: 477-692
Classification Level Classification E-value
Superfamily Smc hinge domain 2.48e-41
Family Smc hinge domain 0.00055
Further Details:      
 
Weak hits

Sequence:  tr|A7TDK5|A7TDK5_VANPO
Domain Number - Region: 692-838
Classification Level Classification E-value
Superfamily Tropomyosin 0.0203
Family Tropomyosin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TDK5|A7TDK5_VANPO
Sequence length 1211
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1018p2
Sequence
MYIHRIVIKGFKTYRNETVIDFFSPNYNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE
RQGLIHQGSGSVMSASVEIVFRDPGHRMILPSGVVPRENDEIFIRRTVGLKKDDYQVNDR
NVTKSDVVRMLESAGFSMSNPYNIVPQGRIIAVTNAKDKERLQLLEDVVGAKSFESKLRA
SLKKMDETEQKRKKISEEMSELNKKLGDMEEERKELEKFNALEGKRKVLQFTLYDREIND
IINQIEGLDSEYNNILASSEEYLQQLNKRETVVEEMTTILQDIDASLKLKGTTELQQSKI
KYQELSNGLVDSQVKMKEIKSQLDSQTEQSKIDEKNLKIIAEAIKEKQSELGKILPRYEQ
LNQDEAKYKNELFDLKQKQKELMLKRGSYARFKTKEERNEWIHSEIEDLQEELTNLETTK
ITLAERRNEIQEELKTYEEQIDELLDSVQGPGVSAELEDLKSEIESLKSSYADKFDERKE
LWRTEQKLQTVLENMADSVKRSERAVNESMSRSLANGIASVKEITEKLNLPDDAVFGTLG
ELIKVSEKYKRCAEVIGGNSLFNVVVDTEETATIIMNELYHMKGGRVTFMPLNRIHVDNN
ITYPPNEQASCTPLIKKIKYDVRYEKAVKHIFGRTIVVKDLLEGSKIAKKLKLNAVTLDG
DRADKMGVLTGGYHDQHKKTRLDTLKELKVSRQQHIRTSKELEDVREKLQVLDSEIDKLN
DSIRKATNNREAILTNIDSLNVKLNNLKNEKNLLEESSSSSENKLERTEAYYLTTQTKLE
AFRQDLDLPFDSELSPKEKEELENITTYLTELTENFEVTVEALSGLTIQIDSLKAELNSK
LIPQENELKSKLSKNHDTHFNELRGELKAIAIESQSLEDQVELARSELESLEKEISKLND
EKVNSRKMLEKANSQQRMILKKLDAYQLDAEKFMIRKVALSNRREELQIKMREIGLLPEE
GSGNFENSTSSDLFQELNSVNEEMSSLTNVNKRASENFRKFNEKKIELNERAAELDDSKV
SIQNLIEKLKQQKVTAVDSTFKKVSENFSTVFEKLVPRGTAKLIIHRQEENKTRSKDKNS
TESIYSGISISVSFNSKKNEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA
LDKQYRAAVADVIKSLSGNAQFICTTFRTDMLQVADKFFRVKYENKISTVVEVERQEAIN
FIRGNNKIQEV
Download sequence
Identical sequences A7TDK5
XP_001647333.1.22633 tr|A7TDK5|A7TDK5_VANPO 436907.A7TDK5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]