SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TDN2|A7TDN2_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TDN2|A7TDN2_VANPO
Domain Number 1 Region: 750-1008
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9e-57
Family Tandem AAA-ATPase domain 0.0000692
Further Details:      
 
Domain Number 2 Region: 534-707,849-894
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.55e-43
Family Tandem AAA-ATPase domain 0.0000349
Further Details:      
 
Domain Number 3 Region: 1150-1226
Classification Level Classification E-value
Superfamily HRDC-like 0.00000000000203
Family HRDC domain from helicases 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TDN2|A7TDN2_VANPO
Sequence length 1332
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1018p31
Sequence
MVVKPSHNLRRECKWWKDSNSLISDKDLVWQIINDNTKYKSNNKPTKDTTFPISSPNPNP
NPNPNPNPNPNPNPNPNPNPNPNPNPNPNPNYNSGSNSGSNSGSQFSDQTTNNDSAISAT
RPTIPVQPSSNTVPKAKTVSNTPIRQNEDSSLVNNYRNNSSLPKGNNGVSSHIQLIHALL
NKVSLLSSINDIANSTSLSEDNKKIKINKEINPKLIEIDPLINNLLQTLKINPSSIPSYK
EPISDTNSFTGNSPALHSLPSLSVPQISRPSTPSNYVSHEVIEVTDDDENVVKFRNQSLQ
TQDGFTDDPESDNDPNYLLTQAHLRDDVVHKSDEDFIDDDDMDPSQDSEYKEDDEDEYYE
EEEGEEEGDTEKTHTNIQEQRKKATTKRKSKTHENDSDIEVIHSSPAVSNVEHISLINED
LDDESLFKDLTGSNNLVTRKNVSNSDIEALEDDENNDDEEDSGAFDGLSDSDLEQFDEER
ETSKRSVNIKEVDDDLQFISEGKLTNPNPNFNAVVKMEAADETDFIDTIDNIPASMHEKY
RWTNEVNHKLKSIFKLPGFRPNQEDAVNATLDGKDVFVLMPTGGGKSLCYQLPAMIKSGK
TRGTTIVISPLISLMHDQVEHLKSKDIKADMFSSKGTTEQRRNTFNLFILGLLDIIYISP
EMVSASEQCKKAIKKLYVDKKLARIVVDEAHCVSNWGHDFRPDYKELKFFKREYPDIPLM
ALTATANERVILDINHNLSLKDPVFLKQSFNRTNLFYEIRIKNKNSIFEMCNDIKTRFRN
QTGIIYCHSKNSCEQTASLIERSGVKCTYYHAGMEPEDRMKVQQAWQEDKIQVICATVAF
GMGIDKPDVRFVYHFTVPRTLEGYYQETGRAGRDGNYSYCITYFSFKDIRSIQTMIQKDQ
NLDRENKEKHLNKLKQVISYCDNIADCRRKLVLSYFNEKFDEAKCQKNCDNCKNSDKVVT
QEIDITEEAKKIVKLVEQLHHTRLTLNYCQDIFRGSKSSRIVSNGHQNLEAHGAGSNFNR
QDIGRIFLQLVAHGIIEEYAIVNNSGFASNYLKVGPNATRLMSGNLNIPMQVVISSSREG
SATIPKGKASIKNSKDSVGIKTNHINKIIPPQDQRNFLQSYSYDNNLVNSFNNHQPVTIN
NGGNGAQNEAKELNFAFERIKAAVVEISNRSNLPLSTYMPVNAIKKIATFLPATEDEFVV
LLGDNEQNRRKYNDLRHVIMNLRKHKMKSLTGTEDRNTSFNSSLSSESFSSVNDYDYSSA
TGTKSKYFNPSEAETRGNIQILDHLRRNQYVPPNSQPLSNGYMANTSMTRTKYPQKRNFK
TNNRGNSKRMKR
Download sequence
Identical sequences A7TDN2
tr|A7TDN2|A7TDN2_VANPO XP_001647360.1.22633 436907.A7TDN2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]