SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tr|A7TDQ4|A7TDQ4_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TDQ4|A7TDQ4_VANPO
Domain Number 1 Region: 123-189
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.00000000000000161
Family SNARE fusion complex 0.0059
Further Details:      
 
Weak hits

Sequence:  tr|A7TDQ4|A7TDQ4_VANPO
Domain Number - Region: 8-81
Classification Level Classification E-value
Superfamily t-snare proteins 0.00471
Family t-snare proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TDQ4|A7TDQ4_VANPO
Sequence length 219
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1018p56
Sequence
MSAGDEIFEQVVNDAKEQIGRLRNTRRTTKEQREEYLEIVEEIKDTIKDLYKSIEVIKRN
EGGSTVDKEREVENLEKSLKELEINGNSINANYNNRGRIDADEEYVSNMEDNNADVKKNP
LGDIIQEQMYREQSDQLDEIHYTMGQLQEQARTMGDELRDQSELLENIDDGMDTIGSKLS
RGRRQLEWIYEKNREKWNDCCITLLIVVLIILLVMAIII
Download sequence
Identical sequences A7TDQ4
tr|A7TDQ4|A7TDQ4_VANPO 436907.A7TDQ4 XP_001647382.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]