SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TEA9|A7TEA9_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TEA9|A7TEA9_VANPO
Domain Number 1 Region: 3-125
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000548
Family Reverse transcriptase 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TEA9|A7TEA9_VANPO
Sequence length 126
Comment Tkp3 protein (Fragment) OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1002p78
Sequence
SKFCPKFIGHCSPKAGSINQSITDPKIGWLQEQHKCYIKPNSNLCNPHLLVQSHEDGLYR
LTIVVSTEGYGEVLEEIDINHNVIYLGVADYFSRSLQKSHRNYTVSGLELQAITGALRYV
RYILYE
Download sequence
Identical sequences A7TEA9
XP_001647289.1.22633 436907.A7TEA9 tr|A7TEA9|A7TEA9_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]