SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TEE9|A7TEE9_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TEE9|A7TEE9_VANPO
Domain Number 1 Region: 228-483
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.39e-50
Family Leukotriene A4 hydrolase catalytic domain 0.0018
Further Details:      
 
Domain Number 2 Region: 6-213
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 1.05e-35
Family Leukotriene A4 hydrolase N-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TEE9|A7TEE9_VANPO
Sequence length 877
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1002p121
Sequence
MPETNTVELLSLGSPIIPINYKLDLEIDPAKANFKGECVVTFNSRENLFNSFKLHAKDLV
IASATIGDYQLKVKYEKEQEIAIFSHDTPIDVSNHNEILIKYVGKINGIKTHQDKTVGVF
KTNFMDDKTGSSDNVVVATHCQPCFARYIFPCIDEPSNKSSFKLTLRTLKKLQVIGNTKI
ESIANDSLTDFQVVSFTKTVLMTTSLFGFVIGDLDFIKTEVKMPISGTDLPIAVYAPNNV
ELATFTLNTIQKYLPLLESYFNKCYPLDKLDFALLPFLNDMAMENFGLVTILQDHLLLPP
KALGNKFIRQQSQQLIVHELVHQWMGNYITFDSWEHLWFNESFATWLACHLIDQEGDTEN
YWSSFEYLKQLETTMESDIDVKAAKSISGSAKKITTVNQTSDAFDAYTYTKGITILRMIQ
KTVGDEILKESLQKIIGDEERFHAVSCKPIDIWTEISKMNKSENIVNFFSSWTRLQGFPL
ITVTTDQNSNTKLTQHRFVIKGETDDEDIPYHVPLFILKRDGTIDNSNVLMTDRSIELKE
AISLINSGHQGYYRVSYESDEHYVEIRRLIEEDKLEVVEVYKIMEDLCYVMNNYGKEVHE
SGLLTLMDCIIDREDYWSAVSIGLQMLSQRKLTDNLKYKKMLDKLVSKMNWNSKPSELDE
DKVSVMAQLMYMYRDDSKMYGIAEQYCKKLLQGPSNSIHNDMVGSVISVISTKMSMKQYK
QIISLTSNNAGIMSHIYLGEPQSVVTQLIENIGYSRNYEIVKKILHYVNDHISTIAHIDK
MLLGVCNNHGEIVKDKETDVPIHEMLWEWFTTQNDNWNNKWNKTKNEYLQSGITNVSVMV
LQSVLPHSGSQVSQYVSERPNDTFLQNAYKIVSKSSI
Download sequence
Identical sequences A7TEE9
XP_001647329.1.22633 tr|A7TEE9|A7TEE9_VANPO 436907.A7TEE9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]