SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TEF0|A7TEF0_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TEF0|A7TEF0_VANPO
Domain Number 1 Region: 6-99
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.27e-27
Family Chaperone J-domain 0.00027
Further Details:      
 
Domain Number 2 Region: 191-260
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.000000000000129
Family DnaJ/Hsp40 cysteine-rich domain 0.00044
Further Details:      
 
Domain Number 3 Region: 165-199,263-307
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.000000000706
Family HSP40/DnaJ peptide-binding domain 0.0027
Further Details:      
 
Domain Number 4 Region: 327-410
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.000000107
Family HSP40/DnaJ peptide-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TEF0|A7TEF0_VANPO
Sequence length 503
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1002p122
Sequence
MVMSSELYDILNISSNADAKDIKKAYRVLALKYHPDKNNHSEESKVMFQKISEAYEVLID
VEKRKLYDQYGTVDESVIEQMKERKRKSEFMQQRQGMYPSDPFGNVNPLFGSDLAASAGD
LFAQFFGNSNKNSSRFNPFGNMKPNFSNFNNTFENTASVELERGPDIKHTLRCSLKDLYY
GKKTKLRLDRTRLCVLCMGQGSMKKSKCFTCNGLGSLTQTRRMGPMIQTFSQSCPDCQGS
GMFVKRSDTCQSCSGNGYVEERKIFDVEIQPGMVNGQVIILPGEADEVVNTSFGKQKVIA
GDIVLTINQLKDNNFEVINDCDLLLDNFSVNLSKALCGGTIFISNHPSGNLIKIDIIPGE
ILSPGVIKTVANLGMPKEEKRDPDVSIINISKGNLYVKFDIKFPTRLEEDTIAKLKAVLS
EDRYAHAEMADEEAKDVSNLDDLVEIEEHVFNNFEPDYRTIEELINNNSDGFNSTSNDFD
DKSGRDSHKKRRFDEGYSNDGMQ
Download sequence
Identical sequences A7TEF0
XP_001647330.1.22633 tr|A7TEF0|A7TEF0_VANPO 436907.A7TEF0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]