SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TEG9|A7TEG9_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TEG9|A7TEG9_VANPO
Domain Number 1 Region: 7-140
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 4.18e-58
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.000000714
Further Details:      
 
Domain Number 2 Region: 142-274
Classification Level Classification E-value
Superfamily Translational machinery components 5.23e-47
Family ERF1/Dom34 middle domain-like 0.00000117
Further Details:      
 
Domain Number 3 Region: 276-418
Classification Level Classification E-value
Superfamily L30e-like 8.35e-47
Family ERF1/Dom34 C-terminal domain-like 0.0000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TEG9|A7TEG9_VANPO
Sequence length 440
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1036p18
Sequence
MDLETDAEKNIEIWKVKKLIKSLEKARGNGTSMISLVIPPKGQIAMIQKMLTDEYGTASN
IKSRVNRLSVLSAITSTQQKLKLYTRIPPNGLVLYCGDIITEEGKEKKVTFDIEPYKPIN
TSLYLCDNKFHTEVLSELLEADDKFGFIVMDGQGTLFGSLSGNTRTVLHKFTVDLPKKHG
RGGQSAVRFARLREEKRHNYVRKVAEVAVQNFIANDKVMVKGLILAGSADFKTDLAKSEM
FDQRLASRVLKIVDISYGGENGFNQAIELSAETLANVKFVQEKKLLTEYFDEISQDTGKF
CYGIDDTLKALDLGSIDRLIVFENLETIRFVYKDAEDKEVIKFAMPDQEDKSYAIDRATG
QEMEVVEEQLLIEWLAEHYKEYGATLEFITDRSSEGAQFVTGFGGIGALLRYKVNFEQLA
DESDDEYYDSDEAGSDFDFI
Download sequence
Identical sequences A7TEG9
tr|A7TEG9|A7TEG9_VANPO XP_001647134.1.22633 436907.A7TEG9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]