SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TEH4|A7TEH4_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TEH4|A7TEH4_VANPO
Domain Number 1 Region: 6-143
Classification Level Classification E-value
Superfamily Eukaryotic RPB5 N-terminal domain 5.62e-49
Family Eukaryotic RPB5 N-terminal domain 0.00000024
Further Details:      
 
Domain Number 2 Region: 140-215
Classification Level Classification E-value
Superfamily RPB5-like RNA polymerase subunit 3.66e-29
Family RPB5 0.0000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TEH4|A7TEH4_VANPO
Sequence length 215
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1036p23
Sequence
MDQDSERSISRLWRTFRTVKEMVRDRGYFIAQEEIDLSLEDFKAKYCDSMGRPQRKMMSF
QANPTEETMEKFPTMSSLWVEFCDEPSVGVKTMKNFVIHIQEKNYQTGIFVYQTNVTPSA
MKLVPSIPPATIETFHEASLIVNITHHELVPKHIRLSENEKKELLKKYRLKESQLPRIQR
ADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
Download sequence
Identical sequences A7TEH4
XP_001647139.1.22633 436907.A7TEH4 tr|A7TEH4|A7TEH4_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]