SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TEP8|A7TEP8_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TEP8|A7TEP8_VANPO
Domain Number 1 Region: 246-495
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.53e-59
Family G proteins 0.000000106
Further Details:      
 
Domain Number 2 Region: 581-686
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.13e-29
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00012
Further Details:      
 
Domain Number 3 Region: 485-577
Classification Level Classification E-value
Superfamily Translation proteins 1.41e-21
Family Elongation factors 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TEP8|A7TEP8_VANPO
Sequence length 687
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1036p104
Sequence
MSEQNQNFNQPQQGQGQGQGQGQGQGQGQGQYQNYYQNYYQQQQGGYQQQNQGGYQQQNY
GGYQQGGYQQGGYQQGGYQQGGKPQGNYQQQSYGNYQQGGYQQQNYGGYQQNQGRGGYKN
YNNRNNYQNNNGQQQSSQGMTLEDFQKQQEQQQTAKPKKTLKLVSSSGIKLANASKKAEP
TPEKTDAKETTDAKKEASDLPKIEKLEISQKSATTEAETPKETPKEAPAATENTSNAESL
IKQQEDEIDQEVVNDMFGGKDHMSIIFMGHVDAGKSTMGGNILYLTGSVDKRTVEKYERE
AKDAGRQGWYLSWVMDTNKEERNDGKTIEVGRAYFETEKRRYTILDAPGHKMYVSEMIGG
ASQADVGILVISARKGEYETGFEKGGQTREHALLAKTQGVNKMIVVINKMDDPTVNWSEE
RYNQCVANLNNFLKAVGYNIKEDVIFMPVSGYSGAGLKNRVDPKDCPWYTGPALLEYLDA
MNHMDRHINAPFMLPISSKMKDMGTVVEGKIESGHIKKGNSTLLMPNRIPVEIQNIYNET
ENEVDMAICGEQVKLRIKGVEEEEISAGFVLTSPKNPVKSVTKFVAEIAMVELKSIMSAG
FSCVMHIHTAIEEVTITRLLHKLEKGTNRRSKKPPAFAKKGMKIIALLETNEPVCVETYQ
DYPQLGRFTLRDQGTTIAIGKIVKIVE
Download sequence
Identical sequences A7TEP8
tr|A7TEP8|A7TEP8_VANPO XP_001647213.1.22633 436907.A7TEP8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]