SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TER5|A7TER5_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TER5|A7TER5_VANPO
Domain Number 1 Region: 354-588
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.14e-38
Family DNA polymerase beta-like 0.0028
Further Details:      
 
Domain Number 2 Region: 213-289
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 1.57e-16
Family DNA polymerase beta, N-terminal domain-like 0.0011
Further Details:      
 
Domain Number 3 Region: 293-352
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 0.00000036
Family DNA polymerase beta-like, second domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TER5|A7TER5_VANPO
Sequence length 596
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1050p18
Sequence
MLLFQGQQFVILPNSEGSYLGYLTRLIEKNGGHLISSVEDETGSGLATIDSSTIVLLNSS
FVDENFNLIQENFLLRELRPFNISLWNFIKENNLKCIDIKDISIFIKNKKFDLNLVQLVN
IEGHSVFKLNDGVTTVQTIKSEGTNNSSDEKILESKSESESESESESESESESESESESE
SESESESESESESESESESETDIEIDVNRKTKGNNDRIVNPLAKLARKYKVEGDTFRARS
YNLAILSIDKYTLPITSGIQAQKEIPNIGPSIAKKIQRILDTGTLPGLEQASEQFDSLQY
FSTCHGVGSETAKRWNSLKLDSFKDVLEKFPNEFAVEWPILFGWSYYEDWQKKIPRSVCA
KYLQIVEDELFLLDPDFKVELQGSFNRGLPECGDLDLLFYKPGCDDLNVLCRTIEEIAIR
LYKKSFVKCFLQLTEQIEKVFGNQVRERLAKIRLTENKPKKFNLAPRIKKALLGVQLQEP
ISIEPHNEIVELKDNDKFMSLSNEDTSKYDYCRRMDFFICKWSELGSSRIHFTGSSEYNR
WMRLKAIEKGMKMTQHGLFKDDRLLESFNEKKIFELLDIEYVEPQLRNQVNKRQKK
Download sequence
Identical sequences A7TER5
XP_001647019.1.22633 436907.A7TER5 tr|A7TER5|A7TER5_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]