SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tr|A7TET2|A7TET2_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TET2|A7TET2_VANPO
Domain Number 1 Region: 6-141
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.03e-23
Family Cell cycle control phosphatase, catalytic domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TET2|A7TET2_VANPO
Sequence length 148
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1050p35
Sequence
MMSRSISSIKYLSAEELFNWIKQGHSSLHKDLFQVIDVRGSDYIGGHIINCWNYPYKRLS
HDEEYMNQLVDQLEKSRGANDVMNVVFHCAQSQQRGPSAAMKLLRWLDDEQLQHYQISIL
RGGFNYWQDIYGSDSTVTEDYKPDLWSW
Download sequence
Identical sequences A7TET2
tr|A7TET2|A7TET2_VANPO XP_001647036.1.22633 436907.A7TET2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]