SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TET9|A7TET9_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  tr|A7TET9|A7TET9_VANPO
Domain Number - Region: 14-84
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0256
Family Clostridium neurotoxins, catalytic domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TET9|A7TET9_VANPO
Sequence length 100
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1050p42
Sequence
MSSDIECLIRGIPLYNAYGVMFPNVNKLRKFTSDVIDVPVVRGTDEMFNPWYKECEHILN
DCNGHDSSFKTFDDWYKEKYLSSKPHGITDNITLTPVKRS
Download sequence
Identical sequences A7TET9
436907.A7TET9 tr|A7TET9|A7TET9_VANPO XP_001647043.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]