SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TF04|A7TF04_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TF04|A7TF04_VANPO
Domain Number 1 Region: 9-152
Classification Level Classification E-value
Superfamily RPB6/omega subunit-like 6.28e-47
Family RPB6 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TF04|A7TF04_VANPO
Sequence length 153
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1050p110
Sequence
MSDYEEAFNEGNEHFEDFEVEHFSDEENFEEGFRDGETKNEEGKTIITGGLGPDDNQQND
IFRRKTLKERAIPKNDRTTTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAM
KELAEKKIPLVIRRYLPDGSFEDWSVEELVVDL
Download sequence
Identical sequences A7TF04
tr|A7TF04|A7TF04_VANPO 436907.A7TF04 XP_001647108.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]