SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TF45|A7TF45_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TF45|A7TF45_VANPO
Domain Number 1 Region: 379-528
Classification Level Classification E-value
Superfamily Ribonuclease H-like 6.2e-28
Family Retroviral integrase, catalytic domain 0.014
Further Details:      
 
Domain Number 2 Region: 16-160
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0000000000000127
Family Reverse transcriptase 0.017
Further Details:      
 
Weak hits

Sequence:  tr|A7TF45|A7TF45_VANPO
Domain Number - Region: 595-629
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.011
Family Synaptotagmin-like (S variant) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TF45|A7TF45_VANPO
Sequence length 704
Comment Tkp3 protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_2000p35
Sequence
MIDPKIHPTIPPVKEITHTLTPPLNHFKEWITRSLTLKLFDPTAPTIIFTDASLTGGASI
IFQPETHNKKQILFPITFLSVRFTPTQQRYSTVERELFAVLHALEKGNLLLSSEITIYTD
NKGIISIGNSDRNTHPRFTKFLDLLNGHRLKWKYLPGTKNVLADYLSRFGLKDQPELDLD
LLQKDAIDLPVATLSSLNLNSTDASPNSTTIDPASSVPLSTDNTNTPEITSNTTPSEQDE
TEESLDPNYVVDNVNSLTMSQLIQIQTLLSTKETLIPHLFSKVIDKFLYISDLLYINLDL
VLYRVVIDNDYIEVATKLHGLYHCTHRVLQLAMNDQKLWNPNSNLLLLDVVKQCPRCETY
QKFRDIPIELPEIRRIPVFSRWHLDFAGPLKDKDGYKYFLLAADYTSNLILVKPLREQTF
HSVYEIMRAIYAIFGSPHMLITDNGRQFANAIIPQVARSLKLKYYQSSAYHPRGNSKAER
SVKMIKEVLKKLDPTFTNWVTNIFVAANIVNNTKMLYGYSPREIAFGLPSENIEVDFQQA
VKSLLQKENNETGEQITNQEQAHLSLMSHVKTNDIRLKMTDERIKIRELLKNARKDTDNY
VPYTRGEIVYRLRVKKNTFEPTWDGPYHIEEVVAKNTYKLRDRDGKVRKATYDGSKLKPA
YSFYGSAIRTAAEYTRVYGDKERKYFLKTLGDIDKYIAKEPKRD
Download sequence
Identical sequences A7TF45
XP_001646928.1.22633 436907.A7TF45 tr|A7TF45|A7TF45_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]