SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TF54|A7TF54_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TF54|A7TF54_VANPO
Domain Number 1 Region: 247-326
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.34e-23
Family Canonical RBD 0.0053
Further Details:      
 
Domain Number 2 Region: 1-65,96-190
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.45e-18
Family Cyclophilin (peptidylprolyl isomerase) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TF54|A7TF54_VANPO
Sequence length 338
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_2000p44
Sequence
MSVLVETTIGSFGVTLDCKDSSVEAYNFLKLCKANYYNYQCFYDIRKGHSIEFGDGLYRF
KDRKELRVHSTFINSLLNKNNVDTIVPELATCSSSVNTKEADMGRIGFKTTFKDKERLIG
SKVVVALTDWDSNDGSVSFFGRVNRRNWDVLDNFNRAIIDEKNELVTDIRIIKMHILKDP
FPDPEGFCEYEISLPIDEVRLPQHIIDNSVPSSSKEIQDIKKDILRKETTLEIIGDIPSV
GVRPLENVLFICKLNPSTKAKDIAMIFQRFGEIKSVEIIKDKESGYSLGYGFIEFTTKHS
CELAYTKMESTIIDDRRIHVDFCQSVGKLSKDWIEGKL
Download sequence
Identical sequences A7TF54
tr|A7TF54|A7TF54_VANPO XP_001646937.1.22633 436907.A7TF54

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]