SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TF62|A7TF62_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TF62|A7TF62_VANPO
Domain Number 1 Region: 503-559,627-667,753-886,915-1174
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.22e-87
Family DNA polymerase I 0.00038
Further Details:      
 
Domain Number 2 Region: 108-146,178-197,228-519
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.67e-72
Family DnaQ-like 3'-5' exonuclease 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TF62|A7TF62_VANPO
Sequence length 2211
Comment DNA polymerase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_2000p54
Sequence
MSFGGNKFKGSTTARFVRNPGGSSSNNYALTAQQLLQSSKVDEIDTMMGFERYIPPQFSG
SVDPNKLNQVPGRVGWMINMHPTVISEDTLHGTHEGSSNGGNIGIAGVDFYFLDEEGGSF
KSSITFNPYFFVTCTDDTRINDVEEFLKKYLESCLKSVDIIYKDDLDMDNHLVGLKKTLI
KLSFINSNQLFEARKLLRPILADNENNKLQRDLYNKNLNNQGKNVDAKQLIHDIREYDVP
YHVRVSIDKDVRVGKWYKVTAAGFIEYTEKVAFADPVVLAFDIETTKAPLKFPVSSVDQI
MMISYMIDGEGYLITNREIISEDIDDFEYTPKPEYQGIFTIFNEVDELALLQRFFEHIRD
VRPTVISTFNGDFFDWPFVETRSKIHGLDMFEEIGFAPDSEGEYKSSYCVHMDCYRWVKR
DSYLPQGSQGLKAVTQSKLGYNPIELDPELMTPYAYEKPQYLSEYSVSDAVATYYLYMKY
VHPFIFSLCTIIPLNPDEVLRKGTGTLCEMLLMVQAYQKNIVLPNKHTDPIERFYDGHLL
ESETYVGGHVESLEAGVFRSDIKNKFKIDPEVVDDVLNDLTDALKFAVEVENNADLSKVT
NFDEIKNDITTKLLDMKNNLDRDELPLIYHVDVASMYPNIMTTNRLQPDSMKTERDCASC
DFNRPGKNCDRRLKWAWRGNFFPSKMDEYNMVKRALQNETFKNKNKFSKKPFLTFDELSY
TDQVTHIKKRLTDYSKKVYHRTKVAEVVEREAIVCQRENPFYVNTVRSFRDRRYEFKGLA
KTWKQNMSKIDKSDKHAKEEAKKMIVLYDSLQLAHKVILNSFYGYVMRKGSRWYSMEMAG
ITCLTGATIIQMARSVVEGVGRPLELDTDGIWCILPKSFPENYFFELENGKKLFMSYPCT
MLNYKVHQKFTNDQYQELIDPIRHKYKTHNDNSIFFEVDGPYKAMVLPTSKEEGKGIKKR
YAVFNHDGSLAELKGFELKRRGELQLIKNFQGDIFKVFLDGDSLESCYKAVADVANRWLD
VLDTKGTMLEDEDLIELICENRSMSKTLKEYEGQKSTSITTAKRLGEFLGNEIVKDKGLQ
CKYIISSKPVNAPVTERAIPVAIFSADIQVKRSFLRRWLMDPTLEDFDPRTIIDWDYYRE
RVASVVQKIITIPAALQDVSNPVPRVEHPEWLQKKIAKKNDKSKQSSLNKFFTKTSELPS
NRKVNDIEDMFNSEADGIKPKVAKVSTKKSIAKRRREQKTAEEESLVLPTEMPSMEEDYV
AWLKYQKIKWKIQRRDRNRRAQLFGNSSTSADRSMLGSLIRQQAETYANSVWEVIQYKPS
GQPGELDVFVNINGKIQLLKFKVPKTIYMKFKNETLPLSKIKSCIAEKSNYLLPNNHVLN
YSRDGSLFKLTLPEAEYLNEREDSTSILNDEGVLGIFESTISSSERAIMELGSSVLFSSN
AMGSLGKGLQKGFDMKNLSMTDNDKYLSKFSYTISYLVHFTTDIGYEFFCLYKSWGNMAD
IFVLKPSNQAQELSASSIESMFKETYAMKEDKLDKLSHIIDFSEGVKFEVQNFRDITKLY
RKLSNSITKMKDEKGLQFIMLIQSPFINKIMNTVRVINQIPTIHLGMKELSLPQLNWQSV
LARKICSHILLCGQWLSHLVELSRYSNIPIGNLQLNNIGYIIDILYARKLKSESIVLWWN
ENSPLADIGGIQKEFDLNSSWIMNNLDFPEINNPDVYDNVTLEVSINNLTVNTVLTSALI
NDAEGSDLADVGFSNNTESGETSSSLFIQDSFSSTSLIVLRNLLKTWWDHALKENSTADL
LVNSFVSWVQNSDSKLFDGSLRYHVYNLTKKSLLQLMNEFTSLGSTVVYADRNKLLVKTS
KQSPANCYAYGQYIIKAIRSSTTFTYLDLNIERYWDLLIWMDKFNFGGLACVKIENTEKQ
ELSAYSQWQIKNFLPSIYQSEFDDWMLIILDSMYKSKEKYLETNAGTQRLTQLPPQRNQE
IEDDEVTSLNHFTDLFNKPLLKRMQKLFRNQQEFILDPQYSQDYAFPLLPGSHLQMKNPL
LELVKYLCHVMLLSSKTILEVRELRKELLKIFEVREFDKSGEFQNPSNNLTISGFLCENC
FFISDIDFCRADSSTIFNCDRCQKALNKETLEEHLIQKLCSEVEAYIVQDSRCSKCHKIK
EDYMSEHCSCSGRWECIIPQSRMLKSLKVFGQVASYYKLEGLTSSIMEVGV
Download sequence
Identical sequences A7TF62
tr|A7TF62|A7TF62_VANPO 436907.A7TF62 XP_001646945.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]