SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TFC8|A7TFC8_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TFC8|A7TFC8_VANPO
Domain Number 1 Region: 55-737
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.12e-159
Family Neurolysin-like 0.00000000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TFC8|A7TFC8_VANPO
Sequence length 739
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_2002p12
Sequence
MFKAITTGLRNSNKNSNSIISGKTLKNRKTRIVSFFAVPAIAFTILKYSTMTNSSLLIAP
QPAPTWNWTPEGIVKDAESLIKDSNRIFDNLAAISSPTVENFIVPYMNHENKVSPLINQL
TFLQHVSADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEKSDSK
NYESYRFIEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKEFIAFTKE
ELDGVSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVP
ENEALFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPLGLKEI
EILKQLKEKDMKELNLPYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYYPIESSIDGML
KIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGH
AANFGISSSYVDENDKRSYPVTALVCNFSKPTSDKPSLLKHNELTTFFHELGHGIHDLVG
ANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIPESLIESLVSTK
HVNGALFALRQLHFSTFDMEVHTAEDVSKLNLLELWNGLREQICLVENGDEMSKGYDSFG
HIMSGAYSAGYYGYMWAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRGGIYEVNDNLE
EFLGREPNNSAFLKEMGLN
Download sequence
Identical sequences A7TFC8
436907.A7TFC8 tr|A7TFC8|A7TFC8_VANPO XP_001646800.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]