SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TFR2|A7TFR2_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TFR2|A7TFR2_VANPO
Domain Number 1 Region: 29-193
Classification Level Classification E-value
Superfamily Cyclophilin-like 3.65e-67
Family Cyclophilin (peptidylprolyl isomerase) 0.0000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TFR2|A7TFR2_VANPO
Sequence length 216
Comment Peptidyl-prolyl cis-trans isomerase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1023p39
Sequence
MNPLQLIISTLFLFASFALAGKDEKEPEVTRSVYFDIEHGGKELGRIIIGLYDSVAPRTV
ENFYQLTMSPDPEMGYLDSIFHRIIPNFMIQGGDFTHGTGVGGKSIYGAVFDDEDFTLKH
DRPGRLSMANRGKNTNGSQFFITTVKTPWLDGKHVVFGQVIEGLDVLSQLETVATDRMDK
PLEEVKIVGCGAIDIVPSAKIDEYVAEHPEPVHDEL
Download sequence
Identical sequences A7TFR2
XP_001646728.1.22633 436907.A7TFR2 tr|A7TFR2|A7TFR2_VANPO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]