SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TFR3|A7TFR3_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TFR3|A7TFR3_VANPO
Domain Number 1 Region: 16-189
Classification Level Classification E-value
Superfamily Cyclophilin-like 7.45e-70
Family Cyclophilin (peptidylprolyl isomerase) 0.00000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TFR3|A7TFR3_VANPO
Sequence length 192
Comment Peptidyl-prolyl cis-trans isomerase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1023p40
Sequence
MRLFSIVSVFCYLLFCVTATTEPKITQRVYFDINHGDEKLGRVVIGLYGDVVPKTVKNFY
QLATSKDPKFGYINSVFHRVIPNFMIQGGDFTHGLGIGGKSIYGKSFKDENFTLKHDRPG
RLSMANAGPNTNGSQFFITTVETAWLDGHHVVFGQVIEGMSIVNKVENVPRDGKDKPKKT
VKIVACGDYDLL
Download sequence
Identical sequences A7TFR3
tr|A7TFR3|A7TFR3_VANPO XP_001646729.1.22633 436907.A7TFR3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]