SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TFR8|A7TFR8_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TFR8|A7TFR8_VANPO
Domain Number 1 Region: 20-263
Classification Level Classification E-value
Superfamily Carbamate kinase-like 3.8e-59
Family PyrH-like 0.0001
Further Details:      
 
Domain Number 2 Region: 335-437
Classification Level Classification E-value
Superfamily PUA domain-like 0.00000000000182
Family PUA domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tr|A7TFR8|A7TFR8_VANPO
Sequence length 441
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1023p45
Sequence
MLEEQGFESQDKENMPNTYTIVIKVGSSSLVDEQTKEPKLAIMSKLVETVVRLRRAGHKV
AIVSSGGIAVGLRALGLPKKPKHISEIQAIAAVGQGRLIGRWDLLFSQFNQRIAQVLLTR
TDIMYWRQYRNAQNTLNELLKMGVVPIINENDTLSISEIKFGDNDTLSAITASIVGADYL
FLLTDVDCLYTDNPRTNPDATPILIVPDISKGLPGVKIDSGGGSSVGTGGMETKLVAADL
ATNAGVHTIVMKSDVPENINKIVDYIQSLDINLSGNGEKKIEEENGCDLFELQRKELERL
EEMEVPLHTKFLANDDNHHLKNREFWILHGLVANGAVIIDEGAYKALTRRNKAGLLPAGV
IEVEGSFHELECVELKIGKRLPNGELDTSIPLRTCGKARCDYSSIEISRIKGLQSDEIEN
ELGYADSEYVAQRENMAFPPN
Download sequence
Identical sequences A7TFR8
tr|A7TFR8|A7TFR8_VANPO 436907.A7TFR8 XP_001646734.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]