SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TFR9|A7TFR9_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TFR9|A7TFR9_VANPO
Domain Number 1 Region: 29-125
Classification Level Classification E-value
Superfamily N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.000000000157
Family N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TFR9|A7TFR9_VANPO
Sequence length 126
Comment ATP synthase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1023p46
Sequence
MNTSFNIIFRRGMARSLGARGLVKSQPKFGLDGTYATALFKAAIKTSSLESVSHSLSRLS
SHVSNDHHYYTNVKTLPESDRIEIAKKLIKTDDSMERSIKSLIKVLATNNSLELIPKIST
SYNTLL
Download sequence
Identical sequences A7TFR9
tr|A7TFR9|A7TFR9_VANPO XP_001646735.1.22633 436907.A7TFR9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]