SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TFS7|A7TFS7_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TFS7|A7TFS7_VANPO
Domain Number 1 Region: 1-148
Classification Level Classification E-value
Superfamily SNARE-like 6.41e-49
Family SRP alpha N-terminal domain-like 0.0000057
Further Details:      
 
Domain Number 2 Region: 386-611
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.21e-35
Family Nitrogenase iron protein-like 0.00022
Further Details:      
 
Domain Number 3 Region: 280-363
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 0.000000000297
Family Domain of the SRP/SRP receptor G-proteins 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tr|A7TFS7|A7TFS7_VANPO
Sequence length 612
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1023p54
Sequence
MFDQLVIFTPTGEVLYEYNPLNKKAMLNQVNAFISHLVNMPVSKKDDINSKLTIINVTQE
KSTRSFSAMFHISKQPELYFVITYAEQSLELNNEAESTLNLVLALWDSLDLNQSILENMK
GKSGKNEHNYCEVLQDLNETIKTFDKYFIAKYEDSIKKIGTSTTSNKNVKEKSNVKGNNS
KDSISKQNKNQSNTKSGGRKWGRDGNMVEEFHGDTSTLDFSEDSKNGTPTSNLVLDPTFD
KDSFGERTNKGEFLIKEIDDLLSSNQKEQNISDAKTNSTLNSAFGFLQKHLLGNKTITDD
DLKSALTKLKDQLITKNVAPEAADFLTQQVSRDLVGSKTANWTSVENAAHESLTKAITQI
LTPGVSVDLLHQIQKKTSQPGPDGKKVPYVFSVVGVNGVGKSTNLSKLAFWLLQNNLKVL
IVACDTFRSGAVEQLRVHVENLAQLTDESHVRGSKNKRGKSGNDYVELFEAGYGGSDLVT
KIAKQAIKYASDNDFDIVLMDTAGRRHNDATLMSPLKSFAEQAKPDKIIMVGEALVGTDS
VQQAKNFNNAFGKNRNLDFFIVSKCDTVGGMLGTMVNMVYATGIPILFVGVGQTYTDLRT
LSVKWAVDTLMS
Download sequence
Identical sequences A7TFS7
436907.A7TFS7 tr|A7TFS7|A7TFS7_VANPO XP_001646743.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]