SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TFW7|A7TFW7_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tr|A7TFW7|A7TFW7_VANPO
Domain Number 1 Region: 545-659
Classification Level Classification E-value
Superfamily AMPKBI-like 4.84e-18
Family AMPKBI-like 0.0013
Further Details:      
 
Domain Number 2 Region: 355-409
Classification Level Classification E-value
Superfamily E set domains 0.0000331
Family AMPK-beta glycogen binding domain-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TFW7|A7TFW7_VANPO
Sequence length 667
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1023p98
Sequence
MGNNISVDATNEFRYKGKNIQYFNPYYNKDKKDISNNLILENSVNLENFNNQNTMNLSNN
NLMECLAKLSIDHSNSNSNYSYSTKTLFMNPGHSSPVVCQTPRLTATGSFENRSIFLNND
DSEASSLIIPKTFDESYLMDQNSALFTIEQSSNDDDRKYTTKENKNKTSHFSWKKEMKRR
ISRISKDKHPKDIYYDGSEEDESDDSNAIVHRHTKDRKRLKSDITVDPSLSDKDSSEIKK
EEDNIGSIPIDFTPSNNNEINKKSNFSLHYNDYVNCISSNGTPSITLDTGSSISTAEYEL
TSLRRYHSRVNVVLRWRDSYIQNETCKSVSIISEDILTSVQAQNSGVLLISNFSMTYDKN
ENNWVLPDLFLPPGKYRLRFLIDHHDFRYSNYLPVTEDELGTIINEIEILPGYKSVEPFE
HNNHIMIQENIINSELSLNNSRQLQSEPPSYPELEENFSSPIESIISEDELDNDQYSKVY
GKRNNSIGQSKTSLSIKPCISEVTYTNEIPQLFKITDNNCIVNENYERYGFVEPPSYGEP
GLENRVIDCNQDILFATFQQNGAVDVELAEQLFLEKYPVPDLPVFLDSHFSEKLFDNNDS
SKNLNDMNGEDIQIKNNGQDIPHVNLNHVLTNKISNGMISVACTTRYKRKFVTHILYSPS
THSEVGF
Download sequence
Identical sequences A7TFW7
436907.A7TFW7 tr|A7TFW7|A7TFW7_VANPO XP_001646783.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]