SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tr|A7TFZ2|A7TFZ2_VANPO from Vanderwaltozyma polyspora DSM 70294

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  tr|A7TFZ2|A7TFZ2_VANPO
Domain Number - Region: 21-73
Classification Level Classification E-value
Superfamily Tropomyosin 0.049
Family Tropomyosin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tr|A7TFZ2|A7TFZ2_VANPO
Sequence length 199
Comment Putative uncharacterized protein OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_1028p22
Sequence
MSDSFIQYKKSIKERLDNADLLVSKVIHENTLLSQQLDSRNEEISYMKEKLDKHKTKVDS
LNDKITKQNENLEIFKDLFEHLCGVRVHKSYEDDTGLWFDVSQGSDSGVMDYKLGFVKGE
SSQSNENDENIDENEEDKVNDNSGSGTQVIYVPLLKQRTSSELKVLQNQLPSYMFDTLSF
PLKSLNQFYAKLARSLNKK
Download sequence
Identical sequences A7TFZ2
436907.A7TFZ2 tr|A7TFZ2|A7TFZ2_VANPO XP_001646607.1.22633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]